DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and C29F7.2

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans


Alignment Length:294 Identity:55/294 - (18%)
Similarity:104/294 - (35%) Gaps:103/294 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PLLVTQQSQDA---SLPTWVEKKELEALVKQISEFRKIESLRWKWETQLAEP---ALCVHIQVLV 62
            |::|.:..:|.   .:.|...:::|..:|.:|.:.........:|:|.:.:.   .:..:.|.:|
 Worm   141 PVIVMEMFEDCKVYDIITGFNEEQLYKIVDEIVKLHIFSLTTEEWKTIVPDAFVLEMAGYFQTMV 205

  Fly    63 ADNKKRQVSYLIKSPETVPVGLKLPRT---GDFSTERHMFEVV-----------------LPALE 107
            |...::    |.:.|     ||:|..|   ..|:|:....:.:                 |.|.:
 Worm   206 AGIGEK----LAQQP-----GLELVSTYIKNTFATDPKFLQNINDEYLEERRISVLTHGDLWAPQ 261

  Fly   108 ELYQNSD--------RIVHFGPPVIQAKLKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKL 164
            .|:..:|        :|.|.|.|     ::..|    :|::...||.| .|.|:...::....||
 Worm   262 ILWDKNDDIAGIIDWQITHRGSP-----MEDFH----HIMSTCTSVEN-RKNLTKPLLDYYFDKL 316

  Fly   165 AAYHAGTAAYIAKTPGKIRELPKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKSFQ 229
            :   :|..|       |..::|..||         |::..|:..|     .|.|           
 Worm   317 S---SGLEA-------KGVKMPWTRE---------EIEEEYKYSF-----INGA----------- 346

  Fly   230 KYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVD 263
                          :..:..|| .|.|:.:||.|
 Worm   347 --------------ALTIFANG-FWANSPVLQTD 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 46/236 (19%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 37/200 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.