DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and F58B4.5

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:343 Identity:67/343 - (19%)
Similarity:117/343 - (34%) Gaps:126/343 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 YSVANGLKGLSVT----------------------------AMEGVLSKLAAYH---AGTA---- 172
            |:||:||.|..||                            .|:|.:||:|...   .|.:    
 Worm     4 YTVADGLLGTHVTWEDVLEEMQKALDTTATFGDDKTATNISDMKGFMSKIALVEPKWVGASENEE 68

  Fly   173 ---AYIAKTPGKIR--ELPKLRENSKSDE--ETAELKSLYQLRFHESLRSNDARQYEDKVKSFQK 230
               .::.|...::.  |:.||.:.|..||  :.|:||.:.::.  ..|.:.:...|  |:...:|
 Worm    69 LPEKFVVKISSQLPFIEMTKLMDFSSGDEFWDDAKLKGMGEVT--RLLHNREVATY--KILMREK 129

  Fly   231 YVK------SGTEILDSKTSFNVILNGSCWPN----------------NLLLQVDAFGNV----- 268
            :.|      ..::..|.:......|....:||                .::..:.||..:     
 Worm   130 HPKIPFTKVYASKPFDDENKLKAYLISEYYPNIHHIGMHESIPAEDLIPVIHAIAAFSAIGMKLS 194

  Fly   269 -KDTLFSGFHTAQYGPAVYDLF---------SSLLTA--PAEKSSRFDGYVKFYHD-----QLIE 316
             ::|.::  ..|.:...|:..|         :.||.|  |.|...:.:..:|.|.|     |:|:
 Worm   195 EEETKYA--RGADFLDIVFGQFMDEKSIERMNVLLKASFPEEYLEKVEEMLKIYKDYYFQPQMIK 257

  Fly   317 NL-NLLKFLGKKPSLTDLQLDLLKYGHWA-------------------FETATEILPIVLSDFGN 361
            |. |..:|.|.||.||...|       |:                   |:|.:...|.       
 Worm   258 NFKNTCQFFGYKPVLTHSDL-------WSSNFLCTRDGEKVTLKAIIDFQTVSITTPA------- 308

  Fly   362 NDIEELFRNPVFGEQIRE 379
            .|:..||.:.:..:..||
 Worm   309 QDVGRLFASCLSTKDRRE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 51/266 (19%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 67/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I4140
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.