DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and TMPRSS11D

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_004253.1 Gene:TMPRSS11D / 9407 HGNCID:24059 Length:418 Species:Homo sapiens


Alignment Length:256 Identity:80/256 - (31%)
Similarity:108/256 - (42%) Gaps:58/256 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLLLYENRL----SLIR--YVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDC 166
            |...||...:||.|.|...|..    |||.  ::|||||| ........|.:..|   |.|||  
Human   189 GGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHC-FRSNSNPRDWIATS---GISTT-- 247

  Fly   167 ITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLN 231
                  .|.|.:.|....:|..:.|:  |:.|||||:||:..|.:||.|..:||     |....|
Human   248 ------FPKLRMRVRNILIHNNYKSA--THENDIALVRLENSVTFTKDIHSVCL-----PAATQN 299

  Fly   232 L------QISGWDPTKSSQTLITSTVKERNPA-------DCLNRYPSFRSA---SQVCAGGQRKG 280
            :      .::||    .:|.....||.|....       |..|...|:..|   ..:|||..:.|
Human   300 IPPGSTAYVTGW----GAQEYAGHTVPELRQGQVRIISNDVCNAPHSYNGAILSGMLCAGVPQGG 360

  Fly   281 -DTCAGISGSPVMGIMGSGVDE----FVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
             |.|.|.||.|:       |.|    ..|:.||.|:|.| |.....|||||::..:.:||:
Human   361 VDACQGDSGGPL-------VQEDSRRLWFIVGIVSWGDQ-CGLPDKPGVYTRVTAYLDWIR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 80/256 (31%)
Tryp_SPc 108..335 CDD:214473 78/253 (31%)
TMPRSS11DNP_004253.1 SEA 48..143 CDD:279699
Tryp_SPc 186..412 CDD:214473 78/253 (31%)
Tryp_SPc 187..415 CDD:238113 80/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.