DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and TMPRSS13

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001070731.1 Gene:TMPRSS13 / 84000 HGNCID:29808 Length:567 Species:Homo sapiens


Alignment Length:277 Identity:72/277 - (25%)
Similarity:118/277 - (42%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLL------LYENRLSLIRYVLTAAHCV 142
            ||....:......||......|..|...|..:::||.|.|      :....|...::||||||| 
Human   304 CPSQRYISLQCSHCGLR
AMTGRIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHC- 367

  Fly   143 IGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQF 207
               :....:.||:..::...|::.    .:.|.. ..:.:..::..:|.....|  ||||:||..
Human   368 ---FFVTREKVLEGWKVYAGTSNL----HQLPEA-ASIAEIIINSNYTDEEDDY--DIALMRLSK 422

  Fly   208 PVRYTKKIQPICLLDAEFPL--QDLNLQ----ISGWDPTKSSQTLITSTVKE--------RNPAD 258
            |:..:..|.|.||     |:  |..:|.    |:|:..|:.:....:..::|        :...|
Human   423 PLTLSAHIHPACL-----PMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCND 482

  Fly   259 CLNRYPSFRSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIP 322
            .| .|.|:.:...:|||..|.| |:|.|.||.|::    ...:...:|||:.|:|.. |.....|
Human   483 YL-VYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLV----CEQNNRWYLAGVTSWGTG-CGQRNKP 541

  Fly   323 GVYTKIGHFSEWIKANL 339
            |||||:.....||.:.:
Human   542 GVYTKVTEVLPWIYSKM 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 72/277 (26%)
Tryp_SPc 108..338 CDD:238113 67/250 (27%)
Tryp_SPc 108..335 CDD:214473 65/247 (26%)
TMPRSS13NP_001070731.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
13 X 5 AA repeats of A-S-P-A-[GLQR] 9..93
4 X 5 AA repeats of T-P-P-G-R 14..68
DUF3682 16..>87 CDD:289231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..157
SRCR_2 231..320 CDD:292133 4/15 (27%)
Tryp_SPc 325..554 CDD:214473 66/250 (26%)
Tryp_SPc 326..557 CDD:238113 67/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.