DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Prss54

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006531428.1 Gene:Prss54 / 70993 MGIID:1918243 Length:429 Species:Mus musculus


Alignment Length:257 Identity:65/257 - (25%)
Similarity:107/257 - (41%) Gaps:39/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPVFRDRGAEN-AELNEYPWMVLLLYENRLSLIRYVLTAAHCVIGGY--------LTQNDL 152
            ||.......|:..|| ....|:||:|.:..:      :|...|..|::..:        |.....
Mouse    68 CGIQKATIADKLKENLVSSTEFPWVVSIQDK------QYTHLAFGCILSEFWILSTASALQHRKE 126

  Fly   153 VLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGF--TSSGGTYRNDIALLRLQFPVRYTKKI 215
            |:..|  |.|..|    ..:..|.:..|.....|:.|  .|.|    |:||||:.:..:.:...:
Mouse   127 VIAVV--GISNMD----PRKTDHREYSVNTIIPHENFDNVSMG----NNIALLKTESAMHFNDLV 181

  Fly   216 QPICLLDAEF--PLQDLNLQISGWDPTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQR 278
            |.||.|..:.  |....|..::||:||.::...:|.::..|.....:...|..|.....||...:
Mouse   182 QAICFLGKKLHKPPALKNCWVAGWNPTSATGNHMTMSILRRISVKDIEVCPLRRHQKTECASHTK 246

  Fly   279 K-GDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPG--VYTKIGHFSEWIKA 337
            : .:.|.|..|||:| .....:|.:: |.|:.:||...|     ||  :||.:..:|:||.|
Mouse   247 EPNNVCLGEPGSPMM-CQAKKLDLWI-LRGLLAYGGDSC-----PGLFLYTSVADYSDWITA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 62/246 (25%)
Tryp_SPc 108..335 CDD:214473 59/242 (24%)
Prss54XP_006531428.1 Tryp_SPc 88..299 CDD:238113 57/233 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.