DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Prss22

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:264 Identity:80/264 - (30%)
Similarity:120/264 - (45%) Gaps:42/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPVFRDRGAENAELNEYPWMVLLLYE------NRLSLIRYVLTAAHCVIGGYLTQNDL-VL 154
            ||:...:.|..|.|::...::||:|.:|..      ..|...|:|:|||||    :.:..|. .|
Mouse    99 CGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTNRWVVTAAHC----FKSNMDKPSL 159

  Fly   155 KSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPIC 219
            .||.||..........|:    .|.:.....|..::...||:. ||||:||:..::::::|.|||
Mouse   160 FSVLLGAWKLGSPGPRSQ----KVGIAWVLPHPRYSWKEGTHA-DIALVRLEHSIQFSERILPIC 219

  Fly   220 LLDAEFPL-QDLNLQISGWD------PTKSSQTLITSTVKERNPADCLNRYPSFRSASQ------ 271
            |.|:...| ...:..|:||.      |....|||....|...:...|.:.|  :|.|.|      
Mouse   220 LPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLY--WRGAGQEAITEG 282

  Fly   272 -VCAG---GQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFS 332
             :|||   |:|  |.|.|.||.|:|    ..||:...|.||.|:|:. |.....|||||.:....
Mouse   283 MLCAGYLEGER--DACLGDSGGPLM----CQVDDHWLLTGIISWGEG-CAERNRPGVYTSLLAHR 340

  Fly   333 EWIK 336
            .|::
Mouse   341 SWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 77/253 (30%)
Tryp_SPc 108..335 CDD:214473 76/250 (30%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 77/255 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.