DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Klk12

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:240 Identity:74/240 - (30%)
Similarity:105/240 - (43%) Gaps:47/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 NEYPWMVLLLYENRLS----LI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRC 173
            |..||.|.|.:...|.    |:  ::|||||||        .|..:  |||||.:...:....:.
Mouse    31 NSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHC--------RDKYV--VRLGEHSLTKLDWTEQL 85

  Fly   174 PHLDVEVGQTTVHQGFTSSGGTYRN---DIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQIS 235
            .|       ||......|..|.|:|   |:.||||..|:..|:.::|:. |.:..........:|
Mouse    86 RH-------TTFSITHPSYQGAYQNHEHDLRLLRLNRPIHLTRAVRPVA-LPSSCVTTGAMCHVS 142

  Fly   236 GWDPTKSS--------QTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVM 292
            ||..|...        |.|..|||....   |...:|...:.:.:||||:...|.|.|.||.|  
Mouse   143 GWGTTNKPWDPFPDRLQCLNLSTVSNET---CRAVFPGRVTENMLCAGGEAGKDACQGDSGGP-- 202

  Fly   293 GIMGSGVDEFVFLAGIASYGQ-QYCYSAGIPGVYTKIGHFSEWIK 336
             ::..||     |.|:.|:|. ..|...||||||||:..:::||:
Mouse   203 -LVCGGV-----LQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 74/240 (31%)
Tryp_SPc 108..335 CDD:214473 72/237 (30%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 72/237 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.