DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and zgc:123217

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:280 Identity:84/280 - (30%)
Similarity:119/280 - (42%) Gaps:59/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NKQT---CGQTTPVFRDRGAENAELNEYPWMVLLLYENR------LSLIRYVLTAAHCVIGGYLT 148
            |.||   ||......|..|..:|....:||.|.:.|.||      |...::|:|||||:|     
Zfish    21 NAQTTYECGVAPLNTRIVGGTDAPAGSWPWQVSIHYNNRHICGGTLIHSQWVMTAAHCII----- 80

  Fly   149 QNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTV--HQGFTSSGGTYRNDIALLRLQFPVRY 211
            ..::.:.::.||..|    .|.|.....:|:||..::  |..|.:|  ...|||:|::|..||.:
Zfish    81 NTNINVWTLYLGRQT----QSTSVANPNEVKVGIQSIIDHPSFNNS--LLNNDISLMKLSQPVNF 139

  Fly   212 TKKIQPICL-LDAEFPLQDLNLQISGWDPTKSSQTLITSTVKERNPAD---------------CL 260
            :..|:|||| .:........:...:||......|.|         ||.               |.
Zfish   140 SLYIRPICLAANNSIFYNGTSCWATGWGNIGKDQAL---------PAPQTLQQVQIPVVANSLCS 195

  Fly   261 NRYPSFRSAS----QVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFL-AGIASYGQQY-CYSA 319
            ..|.|..:|:    .:|||...|| ||.|.||.|.....||     |:: |||.|||... |...
Zfish   196 TEYESVNNATITPQMICAGKANKG-TCQGDSGGPFQCKQGS-----VWIQAGITSYGTSAGCAVG 254

  Fly   320 GIPGVYTKIGHFSEWIKANL 339
            ..|.||:::..|..|||.|:
Zfish   255 AYPDVYSRVSEFQSWIKMNV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 77/259 (30%)
Tryp_SPc 108..335 CDD:214473 74/256 (29%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 75/259 (29%)
Tryp_SPc 37..273 CDD:238113 77/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.