DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CELA2A

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:286 Identity:81/286 - (28%)
Similarity:124/286 - (43%) Gaps:57/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LGDVLPNKQTCGQTT-PVFRDR--GAENAELNEYPWMVLLLYENR--------LSLI--RYVLTA 138
            |..::....:||..| |.:..|  |.|.|..|.:||.|.|.|.:.        .|||  .:||||
Human     7 LSTLVAGALSCGDPTYPPYVTRVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGGSLIANSWVLTA 71

  Fly   139 AHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALL 203
            |||:...         ::.|:|....:...:||  ..|.|.|.:..||:.:.|:..:..||||||
Human    72 AHCISSS---------RTYRVGLGRHNLYVAES--GSLAVSVSKIVVHKDWNSNQISKGNDIALL 125

  Fly   204 RLQFPVRYTKKIQPICL------LDAEFPLQDLNLQISGW----------DPTKSSQTLITSTVK 252
            :|..||..|.|||..||      |...:|     ..::||          |..:..:.|:.    
Human   126 KLANPVSLTDKIQLACLPPAGTILPNNYP-----CYVTGWGRLQTNGAVPDVLQQGRLLVV---- 181

  Fly   253 ERNPADCLNR--YPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQY 315
              :.|.|.:.  :.|....|.:||||.....:|.|.||.|:......|..:   :.||.|:|.:.
Human   182 --DYATCSSSAWWGSSVKTSMICAGGDGVISSCNGDSGGPLNCQASDGRWQ---VHGIVSFGSRL 241

  Fly   316 -CYSAGIPGVYTKIGHFSEWIKANLA 340
             |.....|.|:|::.::.:||.:.:|
Human   242 GCNYYHKPSVFTRVSNYIDWINSVIA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 74/258 (29%)
Tryp_SPc 108..335 CDD:214473 72/255 (28%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 74/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.