DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and c1s

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:375 Identity:88/375 - (23%)
Similarity:150/375 - (40%) Gaps:99/375 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSSCQKDE-------KCTRLVSC---SPLMN------------------------ILRPRGMTQA 57
            :|:||.|.       :| :||:|   .|:.|                        :..|.|    
 Frog   338 ISTCQGDGTWKNMHFQC-QLVNCGEPDPIDNGNVFSNTTTYGSEITYNCSDEYYALTLPAG---- 397

  Fly    58 EKDVFAHRQCG--LDPNGHELLHMVYVCCPELGDVLPNKQTCG--QTTPVFRDRGAENAELNEYP 118
            |...::....|  ::..|::.|.   :|.|          .||  |:....|..|...|:..::|
 Frog   398 EDGTYSCSSYGYWVNSRGNKELP---ICTP----------VCGVHQSDKSGRIFGGTRAKPGQFP 449

  Fly   119 WMV----LLLYENRLSLIRYVLTAAHCV--------IGGYLTQNDLVLKSVRLGESTTDCITSES 171
            ||:    :.|....|...|:||||||.|        .||       |:|..    ..|:..:.|.
 Frog   450 WMIQFTDIELGGGSLISDRWVLTAAHVVNKKIFPTMFGG-------VMKFF----PNTNLQSQEK 503

  Fly   172 RCPHLDVEVGQTTVHQGF-----TSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEF-PLQDL 230
            |     ::..:..:|..:     |.....:.|||||::|...|:....|.||||..... |:.:.
 Frog   504 R-----LQAKKIIIHPLYQDNEDTEGQSNFDNDIALVQLTKKVKLGSCISPICLPRRGLAPVVNE 563

  Fly   231 NLQISGWDPTKSSQTLIT---STVKERNPADCLNRY--PSFRSASQVCAGGQRKGDTCAGISGSP 290
            ...|:||..|:..::.:.   :::...:...|....  ..:.:.:.:|||.....|:|.|.||.|
 Frog   564 VATIAGWGKTEKRESAVNLQFASISLSSMDKCKKATGGKGYFTPNMLCAGSDVGKDSCNGDSGGP 628

  Fly   291 VMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
            :| .........:::|||.|:|.:.|   |..|:|||:.::.:||:..:|
 Frog   629 LM-FTDPQDSSKMYMAGIVSWGPRDC---GTYGLYTKVDNYLDWIEETIA 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 12/77 (16%)
Tryp_SPc 108..338 CDD:238113 65/252 (26%)
Tryp_SPc 108..335 CDD:214473 63/249 (25%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943 21/115 (18%)
Tryp_SPc 436..669 CDD:214473 64/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.