DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG34409

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:291 Identity:83/291 - (28%)
Similarity:117/291 - (40%) Gaps:65/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL----------SLI--RYVLTAAHCVIGG 145
            |.|.||.... .|..|.:.|...::||:..:.|.||.          |||  .:::||||||:. 
  Fly   238 NTQGCGINVE-SRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVN- 300

  Fly   146 YLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVR 210
              ..:||.|..||||       :.:...|   ..:.|..||..:...  .|.|||||||:.   .
  Fly   301 --LVSDLELSHVRLG-------SQDGATP---FAIEQVIVHPNYDQP--KYANDIALLRIN---S 348

  Fly   211 YTKKIQPICLLDAEFPLQDLNLQI------SGW-----------DPTKSSQTLITSTVKERNPAD 258
            ......||| |....|:...|..|      :||           ||:.|:..:....:...|...
  Fly   349 TNGTFTPIC-LPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTS 412

  Fly   259 CLNRYPSFR---------SASQVCAGGQRKGDTCAGISGSPVM-----GIMGSGVDEFVFLAGIA 309
            |...|.|..         :.:.:||.|....|.|.|.||.|.|     |:.|:. ..:..: ||.
  Fly   413 CAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTS-GRYTII-GIV 475

  Fly   310 SYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
            ::|...|....||||||.:..||:||..::|
  Fly   476 AFGPTLCGVTTIPGVYTLVSSFSDWILRSIA 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 77/272 (28%)
Tryp_SPc 108..335 CDD:214473 75/269 (28%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 76/272 (28%)
Tryp_SPc 252..501 CDD:238113 75/269 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463218
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.