DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG34436

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:281 Identity:77/281 - (27%)
Similarity:117/281 - (41%) Gaps:63/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 CCPELGDVLPNK-------QTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL---SLIR--YV 135
            |...|..:|.|:       |.|.:.:.:      .|..:...|||.|:|..|:.   :||.  :|
  Fly     6 CLAVLSWMLANQGSAQLLDQNCAEVSRL------SNDIIFSRPWMALVLLPNKTCSGALIHKYFV 64

  Fly   136 LTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHL------DVEVGQTTVHQGFTSSGG 194
            :|:|.||    ..|...:   ||||:.:   |..|    |:      |..|....:|:.:..|  
  Fly    65 ITSASCV----FNQERAI---VRLGQLS---IKQE----HIVSYSSDDYHVQSAYIHRFYEKS-- 113

  Fly   195 TYRNDIALLRLQFPVRYTKKIQPICL-LDAEFPLQDLNLQIS--------GWDPTKSSQTLITST 250
            .:.:|||||.||..|.|...|:|||| ||.    .|::.|:.        |.|.........||.
  Fly   114 NFEHDIALLELQNDVLYKAHIRPICLWLDK----SDIDTQMFKRYETFRWGIDEKYILPAAKTSK 174

  Fly   251 VKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQ-Q 314
            :|..:...|.|.:..:...|.:|||.:.| ..|.. :|||:...:.........|.||.|||: :
  Fly   175 IKHISQVKCENAFKLYPQNSHICAGYKNK-SKCVE-TGSPLFKKIRYYTKIRYTLFGIQSYGESR 237

  Fly   315 YCYSAGIPGVYTKIGHFSEWI 335
            .|       :||.:..:.:||
  Fly   238 TC-------LYTDVTKYIDWI 251

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity