DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG34171

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:221 Identity:45/221 - (20%)
Similarity:86/221 - (38%) Gaps:43/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYR 197
            |:|||:|||:    ..:|.:::...|:..:....:..........|::....:|..:..:   ..
  Fly    65 RHVLTSAHCI----TDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRN---QH 122

  Fly   198 NDIALLRLQFPVRYTK----KIQPICLLDAEFPLQDLNLQISGWDPTK-----SSQTLITSTVKE 253
            ||||:::|:   ||.|    .:.|:.|.::...:.:....|.|....:     |..:::...|:.
  Fly   123 NDIAIIKLK---RYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVEL 184

  Fly   254 RNPADCLNRYPSFRSA-----SQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVF----LAGIA 309
            |...:||....|..:|     ..:|.....| ..|....|.|            :|    |.|||
  Fly   185 RPFDECLKVKKSLMAARPENEDLICVKSTEK-QMCTTDFGGP------------LFCDGQLYGIA 236

  Fly   310 SYGQQYCYSAGIPGVYTKIGHFSEWI 335
             .|...| |:..|..::.:..::.|:
  Fly   237 -LGSINC-SSPDPVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 45/221 (20%)
Tryp_SPc 108..335 CDD:214473 44/219 (20%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 44/219 (20%)
Tryp_SPc 38..263 CDD:304450 45/221 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.