DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and MASP1

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:323 Identity:83/323 - (25%)
Similarity:132/323 - (40%) Gaps:89/323 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VYVCCPE-------LGDVLPN-KQTCGQTTP-----VFRDRGAENAELNEYPWMVLLLYEN---- 127
            :|.|..:       ||..||. ...|||.:.     |.|..|..|||...:||..|::.|:    
Human   418 IYTCSAQGVWMNKVLGRSLPTC
LPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRV 482

  Fly   128 ---------RLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVG-- 181
                     .|....::|||||            ||:|.| .::|...::.|    |:.|.:|  
Human   483 PNDKWFGSGALLSASWILTAAH------------VLRSQR-RDTTVIPVSKE----HVTVYLGLH 530

  Fly   182 --------------QTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL--LDAEFPLQDL 230
                          :..:|..|...  .|.:||||::||.||.....:.|:||  |:.|.|...:
Human   531 DVRDKSGAVNSSAARVVLHPDFNIQ--NYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHM 593

  Fly   231 NLQISGW---DPTKSSQTLITSTVKERNP------------ADCLNRYPSFRSA------SQVCA 274
            ...::||   :|..:...:|:|..:..:.            |:|...|.| ||.      :..||
Human   594 LGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYES-RSGNYSVTENMFCA 657

  Fly   275 GGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASY-GQQYCYSAGIPGVYTKIGHFSEWI 335
            |....| |||.|.||...  ::...:.:...:.|:.|: |.:.|.|..:.|||||:.::.:|:
Human   658 GYYEGGKDTCLGDSGGAF--VIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWV 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 1/3 (33%)
Tryp_SPc 108..338 CDD:238113 72/282 (26%)
Tryp_SPc 108..335 CDD:214473 71/280 (25%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512
CCP 374..439 CDD:153056 6/20 (30%)
Tryp_SPc 456..718 CDD:214473 72/283 (25%)
Tryp_SPc 457..718 CDD:238113 71/282 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.