DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and PRSS2

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:252 Identity:73/252 - (28%)
Similarity:103/252 - (40%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLLLYENRL---SLI--RYVLTAAHC---VIGGYLTQNDLVLK--SVRLGES 162
            |....|.|..|:.|.|......   |||  ::|::|.||   .|...|:.......  .|||||.
Human    26 GGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSAINSKLSGRGCEYHRIQVRLGEH 90

  Fly   163 TTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPL 227
            ..:.:....:.    :...:...|..:.|.  |..|||.|::|..|.....::..|.|..|. |.
Human    91 NIEVLEGNEQF----INAAKIIRHPKYNSR--TLDNDILLIKLSSPAVINSRVSAISLPTAP-PA 148

  Fly   228 QDLNLQISGWDPTKSS--------QTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKG-DTC 283
            ......||||..|.||        |.|....:.:   |:|...||...:.:..|.|....| |:|
Human   149 AGTESLISGWGNTLSSGADYPDELQCLDAPVLSQ---AECEASYPGKITNNMFCVGFLEGGKDSC 210

  Fly   284 AGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
            .|.||.||   :.:|.     |.||.|:|.. |.....||||||:.::.:|||..:|
Human   211 QGDSGGPV---VSNGE-----LQGIVSWGYG-CAQKNRPGVYTKVYNYVDWIKDTIA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 72/248 (29%)
Tryp_SPc 108..335 CDD:214473 69/245 (28%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 69/245 (28%)
Tryp_SPc 24..256 CDD:238113 72/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.