DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and PROC

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:348 Identity:101/348 - (29%)
Similarity:152/348 - (43%) Gaps:84/348 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PRGMTQAEKDVFAHRQCGLDPNG--HELLHMV----YVCCP--ELGDVLPN-----KQTCG---- 98
            ||....||   .:...|.||..|  |..|..|    ..|.|  :|||.|..     |..||    
Human   242 PRPPLPAE---VSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWK 303

  Fly    99 ----QTTPVFRDRGAENAELN------------EYPWMVLLL-YENRLS----LIR--YVLTAAH 140
                :.:.:.||...:..:::            :.||.|:|| .:.:|:    ||.  :||||||
Human   304 RMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAH 368

  Fly   141 CVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRL 205
            |     :.::..:|  |||||  .|....|..  .||:::.:..||..::.|  |..||||||.|
Human   369 C-----MDESKKLL--VRLGE--YDLRRWEKW--ELDLDIKEVFVHPNYSKS--TTDNDIALLHL 420

  Fly   206 QFPVRYTKKIQPICLLDAEFPLQDLN-----LQISGW-------DPTKSSQTLITSTVK----ER 254
            ..|...::.|.||||.|:....::||     ..::||       ...|.::|.:.:.:|    ..
Human   421 AQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPH 485

  Fly   255 NPADCLNRYPSFRSASQVCAG--GQRKGDTCAGISGSP-VMGIMGSGVDEFVFLAGIASYGQQYC 316
            |  :|.....:..|.:.:|||  |.|: |.|.|.||.| |....|:.     ||.|:.|:|:. |
Human   486 N--ECSEVMSNMVSENMLCAGILGDRQ-DACEGDSGGPMVASFHGTW-----FLVGLVSWGEG-C 541

  Fly   317 YSAGIPGVYTKIGHFSEWIKANL 339
            ......|||||:..:.:||..::
Human   542 GLLHNYGVYTKVSRYLDWIHGHI 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 11/38 (29%)
Tryp_SPc 108..338 CDD:238113 79/267 (30%)
Tryp_SPc 108..335 CDD:214473 77/264 (29%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114 13/34 (38%)
Tryp_SPc 328..563 CDD:238113 79/256 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.