DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and zgc:112285

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:309 Identity:75/309 - (24%)
Similarity:119/309 - (38%) Gaps:81/309 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HELLHMVYVCCPELGDVLPNKQTCG----QTTPVFRDRGAENAELNEYPWMVLLLYENRLS---- 130
            |::||:.:            .:.||    :...|.|......|..:.:||.|.|....|.|    
Zfish    35 HKILHLDW------------PKDCGLAHFKPNTVERIVSGNEARPHSWPWQVSLQVRPRGSKHYV 87

  Fly   131 ------LI--RYVLTAAHCVIGGYLTQND---LVLKSVRLGESTTDCITSESRCPHLDVEVGQTT 184
                  ||  .:|||||||...|......   :||...:|..|.    |:|...|     |.:..
Zfish    88 HVCGGTLIHKNWVLTAAHCFQKGKAEDASSWRIVLGKHQLKRSE----TAERFFP-----VKRIY 143

  Fly   185 VHQGFTSSGGTYRN-DIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQ------ISGWDPTKS 242
            .|:.|.....:..: ||||::....::.:..|:..||     |.:.:||.      ::||..|:.
Zfish   144 RHEHFRYPAHSELDYDIALVKAATDIQPSNFIRYACL-----PRKQINLNPGHYCWVTGWGDTRG 203

  Fly   243 SQTLITSTVKERNPADCLNR-------YPSFRSA---------SQVCAGGQRKGDT---CAGISG 288
            .:..::.       |:.||:       |.:.|..         |.:|||.:....|   |.|.||
Zfish   204 GKENVSL-------AEALNQARLPIIDYKTCRQKKFWGDRVRDSMICAGFRDTEGTPAACQGDSG 261

  Fly   289 SPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKA 337
            .|::..:|....|   :.||.|:|...|.....|.|:|:...:..||:|
Zfish   262 GPLLCQVGRDRWE---VHGIVSFGPIGCTVENKPSVFTRTAAYIPWIEA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 3/9 (33%)
Tryp_SPc 108..338 CDD:238113 68/271 (25%)
Tryp_SPc 108..335 CDD:214473 65/267 (24%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 66/270 (24%)
Tryp_SPc 59..308 CDD:238113 68/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.