DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and ela3l

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_021331840.1 Gene:ela3l / 554107 ZFINID:ZDB-GENE-060710-2 Length:270 Species:Danio rerio


Alignment Length:274 Identity:73/274 - (26%)
Similarity:117/274 - (42%) Gaps:63/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPV----FRDRGAENAELNEYPWMVLLLYENRLSLI----------RYVLTAAHCVIGGYL 147
            ||: .|:    .|....|.|..:.:||.|.|.|::..|..          .:|:|||||:..|  
Zfish    17 CGK-PPIEPLMSRVVNGEEARPHSWPWQVSLQYQSGSSFYHTCGGSIIAENWVMTAAHCISSG-- 78

  Fly   148 TQNDLVL---KSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPV 209
             :|..||   ..:.:.|..:..|:::           :..||:.:.|......|||||::|..||
Zfish    79 -RNYRVLVGKHDLSVNEEGSQTISAQ-----------KIIVHEKWNSMFVALGNDIALIKLAEPV 131

  Fly   210 RYTKKIQPIC------LLDAEFPLQDLNLQISGWD--------PTKSSQTLITSTVKERNPADCL 260
            ..:..||..|      :|...:|     ..||||.        |.:..|.|:.:.    :.|.| 
Zfish   132 TLSDTIQLGCVPAPGDVLPNNYP-----CYISGWGRLSTGGALPDRLQQALMPAV----DHATC- 186

  Fly   261 NRYPSFRSA---SQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQY-CYSAGI 321
            :|:..:.|:   :.|||||......|.|.||.|:......|:.|   :.||||:.... |.:...
Zfish   187 SRFDWWGSSVKETMVCAGGDGVVAGCNGDSGGPLNCKNSDGIWE---VHGIASFVSGLGCNTIRK 248

  Fly   322 PGVYTKIGHFSEWI 335
            |.|:|::..|::|:
Zfish   249 PTVFTRVSSFTDWV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 69/259 (27%)
Tryp_SPc 108..335 CDD:214473 68/257 (26%)
ela3lXP_021331840.1 Tryp_SPc 29..265 CDD:238113 69/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.