DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and f10

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001015728.1 Gene:f10 / 548445 XenbaseID:XB-GENE-971433 Length:464 Species:Xenopus tropicalis


Alignment Length:271 Identity:75/271 - (27%)
Similarity:111/271 - (40%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LPNKQTCG-----QTTPVFRDRGAENAELNEYPWMVLLLYE-------NRLSLIRYVLTAAHCVI 143
            ||.:...|     ...|..|..|.......|.||..||:.:       ..:....::||||||: 
 Frog   208 LPERNVTGINILNPNDPNVRIVGGRECSQGECPWQALLVSDEDEGFCGGTILSREFILTAAHCM- 271

  Fly   144 GGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFP 208
                  |......|.:||..|. |:..:...|   :|.:..:|..|..|  ||..|||:::|:..
 Frog   272 ------NQTKYFKVVVGELNTK-ISEGTESIH---KVEKIIMHPRFVKS--TYDYDIAVIKLKEA 324

  Fly   209 VRYTKKIQPICLLDAEFPLQDL----NLQISGW----DPTKSSQTLITSTVKERNPADCLNRYPS 265
            :.:|:.|.|.|:.|.||..|.|    :..:||:    :..:.:.||....|.......|......
 Frog   325 INFTENIIPACIPDPEFADQVLMNEPDAMVSGFGRIHERGRQASTLQMLQVPYIKRHSCKESSTF 389

  Fly   266 FRSASQVCAGGQRK-GDTCAGISGSP-VMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKI 328
            ..:.:..|||...: .|.|.|.||.| |....|:     .|:.||.|:|:. |...|..|||||:
 Frog   390 AITENMFCAGFDTEVKDACQGDSGGPHVTPFKGT-----YFVTGIVSWGEG-CARKGKFGVYTKV 448

  Fly   329 GHFSEWIKANL 339
            .....|:|..|
 Frog   449 SKLHRWLKGVL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 69/246 (28%)
Tryp_SPc 108..335 CDD:214473 67/243 (28%)
f10NP_001015728.1 GLA 22..84 CDD:214503
EGF_CA 85..121 CDD:238011
FXa_inhibition 128..163 CDD:373209
Tryp_SPc 228..456 CDD:238113 68/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.