DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and PLAT

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_000921.1 Gene:PLAT / 5327 HGNCID:9051 Length:562 Species:Homo sapiens


Alignment Length:343 Identity:91/343 - (26%)
Similarity:142/343 - (41%) Gaps:109/343 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 HRQCGLDPNG------HELLH--MVYVCCPELGDVLPNKQTCG---QTTPVFRDRGAENAELNEY 117
            |..| .:|:|      |.|.:  :.:..|    || |:..|||   .:.|.||.:|...|::..:
Human   264 HNYC-RNPDGDAKPWCHVLKNRRLTWEYC----DV-PSC
STCGLRQYSQPQFRIKGGLFADIASH 322

  Fly   118 PWMVLLLYENRLS----------LIR--YVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSE 170
            ||...:..::|.|          ||.  ::|:||||.                           :
Human   323 PWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCF---------------------------Q 360

  Fly   171 SRCP--HLDVEVGQT-----------------TVHQGFTSSGGTYRNDIALLRLQFP----VRYT 212
            .|.|  ||.|.:|:|                 .||:.|...  ||.||||||:|:..    .:.:
Human   361 ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDD--TYDNDIALLQLKSDSSRCAQES 423

  Fly   213 KKIQPICLLDAEFPLQD-LNLQISGWDPTKSSQTLITSTVKERNPADCLNRYPSFRSASQ----- 271
            ..::.:||..|:..|.| ...::||:...::.....:..:||.:    :..|||.|..||     
Human   424 SVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAH----VRLYPSSRCTSQHLLNR 484

  Fly   272 ------VCAGGQRKG-------DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPG 323
                  :|||..|.|       |.|.|.||.|::.:.    |..:.|.||.|:|.. |....:||
Human   485 TVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLN----DGRMTLVGIISWGLG-CGQKDVPG 544

  Fly   324 VYTKIGHFSEWIKANLAP 341
            ||||:.::.:||:.|:.|
Human   545 VYTKVTNYLDWIRDNMRP 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 6/27 (22%)
Tryp_SPc 108..338 CDD:238113 73/283 (26%)
Tryp_SPc 108..335 CDD:214473 71/280 (25%)
PLATNP_000921.1 FN1 41..83 CDD:214494
Important for binding to annexin A2 42..52
KR 125..209 CDD:238056
Kringle 215..296 CDD:306546 10/37 (27%)
Tryp_SPc 313..559 CDD:238113 73/283 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.