DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and epsilonTry

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:257 Identity:70/257 - (27%)
Similarity:107/257 - (41%) Gaps:67/257 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLLLYENRLSLIRYVLTAAH-CVIGGYLTQNDLVLKSVRLGESTTDCITS-E 170
            |.....::.:|:.|        ||.||   .:| |  ||.:..:|:|:       :...|:.| |
  Fly    33 GGYETSIDAHPYQV--------SLQRY---GSHFC--GGSIYSHDIVI-------TAAHCLQSIE 77

  Fly   171 SRCPHLDVEVGQT--------------TVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLL 221
            ::  .|.:.||.|              ..|:|:.|.  |..||||::|::..:.:...|:.|.:.
  Fly    78 AK--DLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSR--TMVNDIAIIRIESDLSFRSSIREIRIA 138

  Fly   222 DAEFPLQDLNLQISGWDPTKSSQTLITSTVKERNPADCLNRYPSFRSAS------------QVCA 274
            |:. |.:.....:|||..|:|.    .||:.:...|..|......|..|            .:||
  Fly   139 DSN-PREGATAVVSGWGTTESG----GSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCA 198

  Fly   275 GGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            ....| |.|.|.||.|::    || |.   |.|:.|:|.. |.....||||..:.||.|||:
  Fly   199 YAPHK-DACQGDSGGPLV----SG-DR---LVGVVSWGYG-CGDVRYPGVYADVAHFHEWIE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 70/257 (27%)
Tryp_SPc 108..335 CDD:214473 68/254 (27%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 68/254 (27%)
Tryp_SPc 31..252 CDD:238113 70/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.