DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP012504

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_001231011.2 Gene:AgaP_AGAP012504 / 4578496 VectorBaseID:AGAP012504 Length:839 Species:Anopheles gambiae


Alignment Length:232 Identity:68/232 - (29%)
Similarity:99/232 - (42%) Gaps:45/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKSV-RLGESTTDCITSESRCPHLD-VEVGQTTV 185
            |::||      ::||||||.     ..:|.|...| |:|:........:.....|. ||:.:...
Mosquito    53 LIWEN------FILTAAHCA-----ADDDNVPPDVARMGDINIYSDEDDEFAQQLKIVEIIRHPK 106

  Fly   186 HQGFTSSGGTYRN---DIALLRLQFPVRYTKKIQPICL-LDAE--FPLQDLNLQISGWDPT---- 240
            |:        |.:   ||||::|:..|.....:.|.|| ||.|  ||    .|..:||..|    
Mosquito   107 HK--------YNSNYYDIALMKLERNVTLHDTVAPSCLWLDDEIRFP----ELLAAGWGRTGFDQ 159

  Fly   241 KSSQTLITSTVKERNPADCLNRYP-SFRSAS------QVCAGGQRKGDTCAGISGSPVMGIMGSG 298
            .:::||:...:.......|...|. ..|...      |.|||.: |.|||.|.||.|:...:...
Mosquito   160 NTTKTLLKVQLAPITNDKCSTHYQRGVRKLENGLMDHQFCAGDE-KMDTCPGDSGGPLHVKLFKE 223

  Fly   299 VDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            .....||.|:.|:|:....:|  ||||.|:..|.:||
Mosquito   224 WKLIPFLVGVTSFGKACGLAA--PGVYVKVSKFGDWI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 68/232 (29%)
Tryp_SPc 108..335 CDD:214473 66/230 (29%)
AgaP_AGAP012504XP_001231011.2 Tryp_SPc 22..261 CDD:238113 68/232 (29%)
Tryp_SPc 22..258 CDD:214473 66/230 (29%)
Trypsin 327..528 CDD:278516
Tryp_SPc 333..>433 CDD:304450
Tryp_SPc 611..836 CDD:304450
Tryp_SPc 611..832 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.