DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP009216

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_001238238.1 Gene:AgaP_AGAP009216 / 4578289 VectorBaseID:AGAP009216 Length:244 Species:Anopheles gambiae


Alignment Length:259 Identity:77/259 - (29%)
Similarity:103/259 - (39%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 AENAELNEYPWMVLLL-----YENRLSLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDC 166
            |.|..|.:.||..||.     :....|||  |||||.|||:....:|...|..|         ||
Mosquito     8 ANNGTLGQLPWTALLKTSSGEFACAASLISERYVLTVAHCIKNRNVTFVQLRKK---------DC 63

  Fly   167 ITSESRC---PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAE---- 224
             ..:..|   |. |:.|.:...|.||  |.....|||||:||...|.:...:.||||..|.    
Mosquito    64 -DEQGVCTLAPQ-DIPVERAIAHDGF--SARRKLNDIALVRLAQNVSFNNDVLPICLPVAPEYQP 124

  Fly   225 -----FPLQDLNLQISGWD-PTKSSQTLITSTVKERNPADCLNRYPSF------RSASQVCAGGQ 277
                 |..:|      |.| .:.::.|:..:.|......:|.||....      ...|.:|....
Mosquito   125 AGSNYFTARD------GQDYASLNTDTISITEVHPLTTENCENRLQELIKRQHKIQESHICGYEA 183

  Fly   278 RKGDTCAGISGSPVMGI--MGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            ...|.||..:|.|::.:  .|..|..     |:.|||.|.|....:|.|||::..|..||..||
Mosquito   184 GSFDGCATSAGGPLVALDRFGRNVQH-----GVVSYGVQDCSLENVPSVYTRVESFINWILHNL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 75/256 (29%)
Tryp_SPc 108..335 CDD:214473 73/253 (29%)
AgaP_AGAP009216XP_001238238.1 Tryp_SPc 14..238 CDD:214473 70/247 (28%)
Tryp_SPc 14..238 CDD:238113 70/247 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.