DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP009218

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_001238239.1 Gene:AgaP_AGAP009218 / 4578285 VectorBaseID:AGAP009218 Length:193 Species:Anopheles gambiae


Alignment Length:154 Identity:45/154 - (29%)
Similarity:63/154 - (40%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL-----SLI--RY 134
            ||..:.....|.|:    :.||.......:....|..|.:.||:..:...:..     |||  ||
Mosquito    11 LHGAHQATAHLLDL----EGCGMNRMQNNETLGNNDNLGQLPWIASIKSSSGQHICGGSLISKRY 71

  Fly   135 VLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHL---DVEVGQTTVHQGFTSSGGTY 196
            |||||||     |..|||....:|    ..||  .||....|   |:.:.:|..|..:...  ..
Mosquito    72 VLTAAHC-----LGHNDLAFVQLR----KKDC--DESGVCTLAKEDIPIERTIGHDSYNKP--VQ 123

  Fly   197 RNDIALLRLQFPVRYTKKIQPICL 220
            .:||||:||.....:...::||||
Mosquito   124 SHDIALVRLTRDASFNSDVRPICL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 2/6 (33%)
Tryp_SPc 108..338 CDD:238113 39/123 (32%)
Tryp_SPc 108..335 CDD:214473 39/123 (32%)
AgaP_AGAP009218XP_001238239.1 Tryp_SPc 39..>193 CDD:304450 39/122 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.