DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG11313

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:395 Identity:119/395 - (30%)
Similarity:170/395 - (43%) Gaps:85/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVYILVLLQAIFF----NQLAECVRLSSCQKDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQ 66
            ||...|||..:..    .|...|  .:..|:...|..:..|.||.::|.....|.:|.......:
  Fly     2 KVIAAVLLCLLIIRTAHGQYVSC--RNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESR 64

  Fly    67 CGLDPNGHELLHMVYVCCPELGD----------------VLPNKQTCG------QTTPVFRDRGA 109
            |.:....    .:.:|||....|                :||::..||      |.|     :|.
  Fly    65 CLVSDQS----DLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQIT-----KGN 120

  Fly   110 ENAELNEYPWMVLLLYE----NRL------SLI--RYVLTAAHCVIGG-YLTQNDLVLK-SVRLG 160
            |.. |.|:.|||||.|.    .:|      |||  |||:||||||... ...:.|:..: |||||
  Fly   121 ETV-LTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLG 184

  Fly   161 ESTT----DCITSESRCPHLDVEVGQTTVHQGFTSSGGT--YRNDIALLRLQFPVRYTKKIQPIC 219
            |..|    ||:........:.:.|.:..:|:.|    ||  :.|||||:||...|.|:..|:|:|
  Fly   185 EHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESF----GTRLFWNDIALIRLAREVAYSPSIRPVC 245

  Fly   220 LLDAEFPLQDLN----LQISGWDPTKSSQTLITSTVKER------NPADCLNRYPSF--RSASQV 272
             |.:...||:..    ..::||..|.:|:   :|.||.:      .|..|..:|.|.  ...|.:
  Fly   246 -LPSTVGLQNWQSGQAFTVAGWGRTLTSE---SSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHL 306

  Fly   273 CAGGQRKGDTCAGISGSPVMGIMGSGVDEFVF-LAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            ||.|:.:||:|.|.||.|:|..     .|.|: |.||.|:|.. |.|...|.|||.:..:..||.
  Fly   307 CAEGRSRGDSCDGDSGGPLMAF-----HEGVWVLGGIVSFGLN-CGSRFWPAVYTNVLSYETWIT 365

  Fly   337 ANLAP 341
            .|:.|
  Fly   366 QNIRP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 9/48 (19%)
Tryp_SPc 108..338 CDD:238113 91/262 (35%)
Tryp_SPc 108..335 CDD:214473 89/259 (34%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 11/59 (19%)
Tryp_SPc 116..367 CDD:238113 92/270 (34%)
Tryp_SPc 116..364 CDD:214473 90/267 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.