DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:271 Identity:66/271 - (24%)
Similarity:107/271 - (39%) Gaps:62/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PNKQTCGQTT---PVFRDRGAENAELNEYPWMVLLLYENR------LSLI--RYVLTAAHCVIGG 145
            |.|...|:.|   |.:.         .:.|::|.||:...      .|:|  .:|||||||..|.
  Fly    28 PIKDIQGRITNGYPAYE---------GKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGA 83

  Fly   146 YLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVR 210
            ...       ::..|.|    |.::.:..|.   ||...:.|....:.|...|||:|:|      
  Fly    84 SGV-------TINYGAS----IRTQPQYTHW---VGSGDIIQHHHYNSGNLHNDISLIR------ 128

  Fly   211 YTKKIQPICLLD-AEFPLQDLNLQ--------ISGWDPTKSSQTL---ITST-VKERNPADCLNR 262
             |..:....|:: .|.|..:...|        .|||..|.....|   :.|. |:..:.:|| :|
  Fly   129 -TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDC-SR 191

  Fly   263 YPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTK 327
            ..|... :.:|........||.|.||.|::...|:.      |.|:.|:|......:|.|.|:::
  Fly   192 TWSLHD-NMICINTDGGKSTCGGDSGGPLVTHDGNR------LVGVTSFGSAAGCQSGAPAVFSR 249

  Fly   328 IGHFSEWIKAN 338
            :..:.:||:.|
  Fly   250 VTGYLDWIRDN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 60/250 (24%)
Tryp_SPc 108..335 CDD:214473 58/247 (23%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 62/261 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.