DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG11842

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:225 Identity:71/225 - (31%)
Similarity:97/225 - (43%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYR 197
            |:|||||||   .|..|..:.:  .|||:...|  |:.......|.:|...|.|..| |....| 
  Fly   111 RHVLTAAHC---HYSPQGSVNI--ARLGDLEFD--TNNDDADPEDFDVKDFTAHPEF-SYPAIY- 166

  Fly   198 NDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQIS----GWD-----PTKSSQTLITSTVKE 253
            |||:::||..||.:.....|.||     |..|..|..|    ||.     |...::.|  ..||.
  Fly   167 NDISVVRLSRPVTFNDYKHPACL-----PFDDGRLGTSFIAIGWGQLEIVPRTENKKL--QKVKL 224

  Fly   254 RN-------PADCLNRYP-SFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIAS 310
            .|       .||..:..| .:.:.:|:|.|.....|||.|.||.||: |..........:.||.|
  Fly   225 YNYGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVL-IYHMDYPCMYHVMGITS 288

  Fly   311 YGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
            .|.. |.:..:|.:||::..:.:|||..||
  Fly   289 IGVA-CDTPDLPAMYTRVHFYLDWIKQQLA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 69/221 (31%)
Tryp_SPc 108..335 CDD:214473 66/218 (30%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 69/221 (31%)
Tryp_SPc 73..312 CDD:214473 66/218 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.