DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG11841

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:288 Identity:78/288 - (27%)
Similarity:108/288 - (37%) Gaps:79/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 TCGQTTPVFRDRGAENAELNEYPWMVLL----------------LYENRLSLIRYVLTAAHCVIG 144
            :|..:.|:..|  ...||..|:|:...|                |..|||     |||||||...
  Fly    64 SCHGSRPLIVD--GTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRL-----VLTAAHCFFS 121

  Fly   145 GYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPV 209
            .:...|     .|||||...|..|.::. |. |..|.....|.||.:.  ...|||.:::|...|
  Fly   122 EHGEVN-----VVRLGELEFDTDTDDAE-PE-DFGVLALKAHPGFENP--QLYNDIGIVQLDREV 177

  Fly   210 RYTKKIQPICLLDAEFPLQDLNLQIS----GWDPTKSSQTLITSTVKER---------NPADCLN 261
            ::.:...|.||     |..|.....|    ||...|.:|......:|.:         :..|..:
  Fly   178 KFNRYKHPACL-----PFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDAND 237

  Fly   262 RYPS-FRSASQVCAGGQRKGDTCAGISGSP-------------VMGIMGSGVDEFVFLAGIASYG 312
            ..|: :...||:|.|.:...|||.|.||.|             ||||..:|:.            
  Fly   238 ELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGIT------------ 290

  Fly   313 QQYCYSAGIPGVYTKIGHFSEWIKANLA 340
               |.:..||..||::.:|..|||..||
  Fly   291 ---CSTPDIPSAYTRVHYFLNWIKGELA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 73/272 (27%)
Tryp_SPc 108..335 CDD:214473 70/269 (26%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 72/274 (26%)
Tryp_SPc 72..310 CDD:214473 71/273 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.