DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG4815

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:245 Identity:50/245 - (20%)
Similarity:83/245 - (33%) Gaps:91/245 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RYVLTAAHC----------VIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQ 187
            |::||||||          ||||         ||..                             
  Fly    69 RHILTAAHCFENLNRSKFHVIGG---------KSAE----------------------------- 95

  Fly   188 GFTSSGGTYRNDIALLRLQFPVRYTKK--IQPICLLDAEFPLQDL----------------NLQI 234
             ||..|..: |...|:|:|...:|.|.  |..:.:...::||:..                .|..
  Fly    96 -FTWHGNNF-NKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKLIA 158

  Fly   235 SGW---------DPTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSP 290
            :||         ...|:.:::....|.:|   ||..:.......:.:|||.......|.|.||.|
  Fly   159 AGWGFEGGVWDESRKKTFRSMKVGIVSKR---DCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGP 220

  Fly   291 -VMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
             ::|....|::.:.|          .|.:...|.||..:.:::::||..:
  Fly   221 LLLGRQVCGINTWTF----------KCGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 50/242 (21%)
Tryp_SPc 108..335 CDD:214473 48/239 (20%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 50/242 (21%)
Trypsin 49..256 CDD:278516 48/239 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.