DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG10232

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:393 Identity:150/393 - (38%)
Similarity:198/393 - (50%) Gaps:65/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRKVYILVLLQAIFFNQLAECVR-----------------------------------LSSCQKD 33
            ||:||:....|.||..|..|..|                                   ...|..|
  Fly   127 RRRVYVNCQRQEIFPCQYDEICRSRDSCPFLKLKRKKAQNILMSRQCGINTYCCPKQEFPDCPAD 191

  Fly    34 EKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGHELLHMVYVCCPELGDVLPNKQTCG 98
            |||.||..|..:.|.....|     .::..:|||.:|....:.....|:||||.|:|||.  :||
  Fly   192 EKCIRLDKCLRIHNTTMEDG-----ANLMDNRQCAIDTRRIDSDKRHYICCPEPGNVLPT--SCG 249

  Fly    99 QTTPVFRDRGAENAELNEYPWMVLLLYENRL----------SLI--RYVLTAAHCVIGGYLTQND 151
            |..|::|......|..||||||.:|:||||.          |||  ||||||||||:...:...|
  Fly   250 QAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTD 314

  Fly   152 LVLKSVRLGE----STTDC-ITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRY 211
            |||:.|||||    :..|| .|.....|.:::.:....||:.:.:: ..:.:||||:|||.||||
  Fly   315 LVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNT-SRFESDIALVRLQTPVRY 378

  Fly   212 TKKIQPICLLDAEFPLQDLNLQISGWDPTKS---SQTLITSTVKERNPADCLNRYPSFRSASQVC 273
            |.:|.|||:.....||.:..|||:||..||:   ||.|:.:||.| |...|.::...||:.||:|
  Fly   379 THEILPICVPKDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYE-NRYYCQDKISFFRNESQIC 442

  Fly   274 AGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKAN 338
            |.|.|..|:|.|.||.|:|..:.:...:.|:||||.|||.:.|.... ||||||.|.|..|||||
  Fly   443 ASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRK-PGVYTKTGAFFSWIKAN 506

  Fly   339 LAP 341
            |.|
  Fly   507 LKP 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 12/48 (25%)
Tryp_SPc 108..338 CDD:238113 108/249 (43%)
Tryp_SPc 108..335 CDD:214473 105/246 (43%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 108/248 (44%)
Tryp_SPc 260..503 CDD:214473 105/245 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.