DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG16710

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:371 Identity:154/371 - (41%)
Similarity:192/371 - (51%) Gaps:45/371 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RKVYI-LVLLQAIFFNQLAECVRLSSCQKDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCG 68
            ::||| .::|.......|||. ....|..||||..|..|:.|:..|:|..||.|||.||..|.||
  Fly     5 QRVYISFLVLHTQLLMYLAES-EYPPCNLDEKCISLARCTSLLPFLKPHNMTPAEKAVFEDRYCG 68

  Fly    69 LDPNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL---- 129
            ..|.|.|||..|.:|||.:|.:|||.|.||...|.:|..|.|..:.||.|||.|:||.:|.    
  Fly    69 YGPKGQELLDRVLICCPNMGHILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVW 133

  Fly   130 ----------SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGE----STTDCIT---SESRC-- 173
                      |||  |||||||||     |....|.|:.|||||    |..||:|   ....|  
  Fly   134 NERLVSRCAGSLITNRYVLTAAHC-----LRITGLDLRRVRLGEHNILSNPDCVTHINGREHCAP 193

  Fly   174 PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL-LDAEF---PLQDLNLQI 234
            .||:::|..:..|:.:........||||||||:||||||.:|:|||: ||..|   ...:..|||
  Fly   194 EHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQI 258

  Fly   235 SGWDPTKS---SQTLITSTVKERNPADCLNRYPS--FRSASQVCAGGQRKGDTCAGISGSPVMGI 294
            :||..:..   |..|:.:.|..||..:|....||  ....:.:|||.....|||.|.||.|:|.|
  Fly   259 AGWGLSHKQGYSNVLLQAYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAI 323

  Fly   295 MGSGVDEFVFLAGIASYGQQYC-YSAGIPGVYTKIGHFSEWIKANL 339
            |..|.:|||:||||.|||...| |.   |..|||...|.|||..|:
  Fly   324 MERGDEEFVYLAGITSYGYSQCGYG---PAAYTKTSKFVEWILWNM 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 23/48 (48%)
Tryp_SPc 108..338 CDD:238113 108/264 (41%)
Tryp_SPc 108..335 CDD:214473 106/261 (41%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 23/48 (48%)
Tryp_SPc 105..362 CDD:214473 107/264 (41%)
Tryp_SPc 106..362 CDD:238113 106/263 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463197
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.