DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG31199

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:283 Identity:58/283 - (20%)
Similarity:104/283 - (36%) Gaps:83/283 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELN---------EYPWMVLLLY----EN 127
            ||.:|.:..||:.....|...||...        |:..||         |:.|:..::|    |.
  Fly     8 LLLLVGLFGPEVRSAKVNDDQCGAFD--------EDQMLNMQSTFAIPTEHQWVARIVYGKGFEG 64

  Fly   128 RLS-------LI--RYVLTAAHCVI--GGYL--------TQNDLVLKSVRLGESTTDCITSESRC 173
            ::.       |:  |.||..|||.:  .|..        ..|......||:.|:...|:.     
  Fly    65 KIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVR----- 124

  Fly   174 PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWD 238
            |..::::.:..:|..:.|.  |.:|.:|:|.||...:....:.|||:     |           .
  Fly   125 PSQEIKLAEIAIHPDYDSR--TLKNSLAVLTLQRDAKIYPNVMPICM-----P-----------P 171

  Fly   239 PTKSSQTLITST-----------------VKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGI 286
            |:..::||:..|                 |...:...|.::..:..::|....|..::  ..|..
  Fly   172 PSLLNETLVAQTFVVAGLRVFEDFRLKTWVNTLSRGFCQSKVKTLVTSSNTVCGYHKQ--PVAYY 234

  Fly   287 SGSPVMGIMGSG-VDEFVFLAGI 308
            .|:|::|:...| |.:..:|.||
  Fly   235 LGAPLVGLQKKGHVTQNYYLVGI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 3/7 (43%)
Tryp_SPc 108..338 CDD:238113 50/251 (20%)
Tryp_SPc 108..335 CDD:214473 50/251 (20%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 45/236 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.