DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG31266

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:276 Identity:67/276 - (24%)
Similarity:104/276 - (37%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLL--LYENRL--SLI---RYVLTAAHCV 142
            |.|.::..::.|  :..|..|..|...|....:||:..:  .|...|  ::|   .:|||||.||
  Fly    33 PGLANIERHRST--EAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCV 95

  Fly   143 IGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQF 207
            .|         |:.:.|...|......:...|:  ..|.|..||..|...  .|.||||||:|..
  Fly    96 AG---------LRPLNLLVVTGTVDWWDLYAPY--YTVSQIHVHCNFDKP--LYHNDIALLQLSS 147

  Fly   208 PVRYTKKIQPICLLDAEFPLQDLNLQISGWDPTKSSQT------------LITSTVKER--NPAD 258
            .:.:....:.|.|.|.:...:...|..:||..:::..|            |.....:|:  |..|
  Fly   148 KIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDD 212

  Fly   259 CLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPG 323
            .        ....||.........|.|.:|.|:       :||...|.||.::|.. | ..|.|.
  Fly   213 V--------DLGHVCVQMDAGQGACHGDTGGPL-------IDEQQRLVGIGNWGVP-C-GRGYPD 260

  Fly   324 VYTKIGHFSEWIKANL 339
            ||.:...:.:||:..:
  Fly   261 VYARTAFYHDWIRTTM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 62/250 (25%)
Tryp_SPc 108..335 CDD:214473 60/247 (24%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 61/250 (24%)
Tryp_SPc 52..275 CDD:238113 62/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.