DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG17475

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:265 Identity:73/265 - (27%)
Similarity:116/265 - (43%) Gaps:66/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FRDR--GAENAELNEYPWMVLL--LYENRL---SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRL 159
            |::|  ..|:.:|.|..:.:.|  :|...:   .:|  |:||||||||.|    .|...|: |..
  Fly    46 FQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYG----YNPTYLR-VIT 105

  Fly   160 GESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAE 224
            |       |.|...|.....|.:..:|..:.|.  .|.|||||:||...:::.:..||     ||
  Fly   106 G-------TVEYEKPDAVYFVEEHWIHCNYNSP--DYHNDIALIRLNDTIKFNEYTQP-----AE 156

  Fly   225 FPLQDL----NLQISGWDPT-----------KSSQT-LITSTVKERNPADCLNRYPSFRSASQVC 273
            .|...:    .|.::||..|           |:..| ::.||.:|     .:|..|| .....:|
  Fly   157 LPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQE-----IMNNDPS-NGPCHIC 215

  Fly   274 ---AGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
               .|||   ..|.|.||.|   :..:||     |.|:.::|  |..:.|:|..:..:.::.|||
  Fly   216 TLTTGGQ---GACHGDSGGP---LTHNGV-----LYGLVNWG--YPCALGVPDSHANVYYYLEWI 267

  Fly   336 KANLA 340
            ::.::
  Fly   268 RSMIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 71/255 (28%)
Tryp_SPc 108..335 CDD:214473 69/252 (27%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/255 (27%)
Tryp_SPc 50..269 CDD:238113 71/256 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.