DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG31265

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:108/262 - (41%) Gaps:64/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RDRGAENAELNEYPWMVLL-------------LYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKS 156
            |.:|.|.||:...|:.|.|             |.||      :::||.|||........:::..:
  Fly    36 RIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNEN------WIITAGHCVENFIPALVNVITGT 94

  Fly   157 VRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLL 221
            .:..|......|:|.   |......|..:|           |||||::|...:.:.:..|||.|.
  Fly    95 NKWAEPGAIYYTAEI---HKHCMYDQPYMH-----------NDIALVKLTENITFNELTQPIALP 145

  Fly   222 DAEFPLQDLNLQISGWDPTKSSQTLITSTVKERN-------PAD-CLNRYPSFRSASQVCAGG-- 276
            .....|.: .:.::||    .|.....|::::.:       |.| |   |.:|...|.:..|.  
  Fly   146 TRPVQLGE-EIVLTGW----GSDVAYGSSMEDLHKLTVGLVPLDEC---YETFNRTSSMGVGHIC 202

  Fly   277 --QRKGD-TCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKAN 338
              .|:|: .|.|.||.|   ::.:|.     |.|:.::|:. | ..|:|.|...:.::.:||::.
  Fly   203 TFSREGEGACHGDSGGP---LVSNGQ-----LVGVVNWGRP-C-GVGLPDVQANVYYYLDWIRSK 257

  Fly   339 LA 340
            |:
  Fly   258 LS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 60/255 (24%)
Tryp_SPc 108..335 CDD:214473 58/252 (23%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 59/255 (23%)
Tryp_SPc 39..257 CDD:238113 60/255 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.