DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and modSP

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:280 Identity:73/280 - (26%)
Similarity:100/280 - (35%) Gaps:56/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KQTCGQ-TTPVFR-DRGAENAELNEYPWMV-LLLYENRL--------SLIR--YVLTAAHCVIG- 144
            :|.||| .||:.: ..|.........||.| |.::.|..        ||:.  .|:||||||.. 
  Fly   355 EQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDE 419

  Fly   145 ------GYLTQNDLVLKSVR-LGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIAL 202
                  .|.|...:..|..| .||:|.:    |.|   .||.:  ..:..|:......|..|:||
  Fly   420 GTRLPYSYDTFRVIAAKFYRNYGETTPE----EKR---RDVRL--IEIAPGYKGRTENYYQDLAL 475

  Fly   203 LRLQFPVRYTKKIQPICLLDAEFP-----LQDLNLQISGWDPTKSSQTLITSTVKERNPADCLNR 262
            |.|..|...:..|:|||:..|.|.     ..|:..:.:||:.....:......|.:.|.. |...
  Fly   476 LTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNIENKHELQFVPAVSKSNSV-CRRN 539

  Fly   263 YPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFV------------FLAGIASYGQQY 315
            ....: |.:.|...|.|...|.|.||       |....|..            ||.|:.|.....
  Fly   540 LRDIQ-ADKFCIFTQGKSLACQGDSG-------GGFTSELPTNAFSTWNTARHFLFGVISNAPNA 596

  Fly   316 CYSAGIPGVYTKIGHFSEWI 335
            ...|....|.|.|.||.:.|
  Fly   597 DQCAHSLTVMTNIQHFEDMI 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 67/264 (25%)
Tryp_SPc 108..335 CDD:214473 66/262 (25%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 66/262 (25%)
Tryp_SPc 371..591 CDD:304450 59/237 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.