DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG3505

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:371 Identity:105/371 - (28%)
Similarity:170/371 - (45%) Gaps:59/371 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVLLQAIFFNQLAE-----CV-RLSSCQKDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQC 67
            :||::.::.....|:     || ::.|.:....|..:..|...|.||....::|:::::....||
  Fly     7 LLVVVGSLALGANAQLPPINCVAKIPSGRVTGHCISIRECDYFMRILLSGNLSQSDRNLLRDNQC 71

  Fly    68 GLDPNGHELLHMVYVCCPE---LG----DVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLY 125
            |:..|.      |.||||.   ||    .:||:  .||:..  ::.....:..:.|:||:.|:.|
  Fly    72 GVRGND------VQVCCPSTAGLGALTHPLLPS--DCGKVR--WQRSNDTDTRIREFPWLALIEY 126

  Fly   126 ENR-----------LSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTT----DCITSE----S 171
            ...           |...||||||||||  .....::|.:.:|||||..|    ||...|    :
  Fly   127 TRGNQEKIHACGGVLISDRYVLTAAHCV--AQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVA 189

  Fly   172 RC--PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEF---PLQDLN 231
            .|  |:.|:.:.:...|..:..:..|..|||||:||..|.:....:|||||.:.:.   .|:||.
  Fly   190 DCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLV 254

  Fly   232 LQISGWDPTKSSQTLITSTVKERNPADCLNRYPSFR---SASQVCAGGQRKGDTCAGISGSPVMG 293
            .:::||. ..|||.:....|...:..:|..:|.|.:   .||::|  |......|.|.:|.|:|.
  Fly   255 TEVAGWQ-ASSSQRMRKGYVTISSIEECQRKYASQQLRIQASKLC--GLTNSQECYGNAGGPLML 316

  Fly   294 IMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            ....|    ..|.|:.|:|...|.:...|.|||::..:.:||..:|
  Fly   317 FKNDG----YLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 12/48 (25%)
Tryp_SPc 108..338 CDD:238113 77/256 (30%)
Tryp_SPc 108..335 CDD:214473 75/253 (30%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 13/57 (23%)
Tryp_SPc 111..356 CDD:238113 77/253 (30%)
Tryp_SPc 111..354 CDD:214473 75/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.