DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG9649

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:283 Identity:66/283 - (23%)
Similarity:116/283 - (40%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QTCGQTTPV----------FRDRGAENAELNEYPWMVLL----------LYENRLSLIRYVLTAA 139
            ||.||.:.:          |...|.| .|..:.|||..|          |....|...|.|::||
  Fly   237 QTIGQLSGICGREKVIQTPFIHNGIE-VERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAA 300

  Fly   140 HCV-IGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRN-DIAL 202
            ||. .|......:..:  |.||.::.|..:|.:     .:.|.:..:|:.:..:  .|.: |:||
  Fly   301 HCFRFGSRNLPGERTI--VSLGRNSLDLFSSGA-----TLGVARLLIHEQYNPN--VYTDADLAL 356

  Fly   203 LRLQFPVRYTKKIQPICLLDAEFPLQ---DLNLQISGWDPTKSSQTLITSTVKERNPADCLNRY- 263
            |:|...|.....|:||||.:..|.|:   .....::||...:....  .:.:.:....|.:.:: 
  Fly   357 LQLSNHVDIGDYIKPICLWNENFLLELPSGHKSYVAGWGEDEKGNR--NTRLAKMTDTDIITQWE 419

  Fly   264 ---------PSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQY---C 316
                     ..|.::..:||...:....|:|.||.   |:|....|.:: |.|:.|.||:.   |
  Fly   420 CRGNLSEENAKFITSHTICASNAQASGPCSGDSGG---GLMLQEQDIWM-LRGVVSAGQRMTNRC 480

  Fly   317 YSAGIPGVYTKIGHFSEWIKANL 339
             :..:|.:||.:....||:.:::
  Fly   481 -NLTLPVIYTDVAKHIEWLLSSM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 61/257 (24%)
Tryp_SPc 108..335 CDD:214473 60/254 (24%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 60/257 (23%)
Tryp_SPc 259..497 CDD:214473 59/254 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.