DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG8870

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:360 Identity:130/360 - (36%)
Similarity:176/360 - (48%) Gaps:58/360 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVLLQAIFFNQLAECVRLSSCQKDEKCTRLVSCSPLMNILRPRG-MTQAEKDVFAHRQCGLDPNG 73
            |::||.|    |......:.||.|.:|..|..|.      |.|. |..:.|::...|:||.:.  
  Fly    10 LLMLQII----LVPYSNGAGCQFDTECVNLDKCP------RTRAVMNSSRKNIIGLRRCGTNK-- 62

  Fly    74 HELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRLSLIR----- 133
                    ||||:....||: .||||:..  :....:...|||:|||.:|||.|:.:|.:     
  Fly    63 --------VCCPKWETYLPH-DTCGQSRR--KPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPK 116

  Fly   134 ---------YVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESR---------CP-HLDVE 179
                     |||||||||...:: .....||:|||||..|.  |:..|         .| ::::|
  Fly   117 CGGSLINNWYVLTAAHCVEYPFM-DYPYALKTVRLGEHNTS--TNPDRAIVNGRRQYAPLYMEIE 178

  Fly   180 VGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAE-FPLQDLNLQISGWDPTK-- 241
            |.|...|:.| :.|....|||||:||:||||||:.||||||..|: ........|.|||....  
  Fly   179 VDQIITHEQF-NRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQG 242

  Fly   242 -SSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFL 305
             :|:.|:.|.:.||:|..|.:.| .|...||:||||....||..|.||.|:|..:..|.....:.
  Fly   243 IASEVLLRSFIAERHPDVCKSNY-DFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYA 306

  Fly   306 AGIASYGQQYC-YSAGIPGVYTKIGHFSEWIKANL 339
            |||.||||:.| .....|..|||..:|.||||:.|
  Fly   307 AGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 11/49 (22%)
Tryp_SPc 108..338 CDD:238113 101/258 (39%)
Tryp_SPc 108..335 CDD:214473 98/255 (38%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 100/251 (40%)
Tryp_SPc 93..337 CDD:214473 97/248 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463201
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.