DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG11670

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:307 Identity:86/307 - (28%)
Similarity:131/307 - (42%) Gaps:55/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRD-RGAENAELNEYPWMVLLLYENRL----- 129
            ||.|...|.:::......|. .|.....:|..:..| .|.......:||.|..|.:.|..     
  Fly   135 PNHHRNFHNIFLNTESKVDG-ENYNKTAETEDLHDDFNGRSIVAPGQYPHMAALGFRNENHEIDY 198

  Fly   130 ----SLI--RYVLTAAHCVIGGYLTQNDLV-LKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQ 187
                |||  .:||||||| :..:.|..|:| :..::|.|...:......|       |.|..:|.
  Fly   199 KCGGSLISEEFVLTAAHC-LTTHGTSPDIVKIGDIKLKEWELNVAPQRRR-------VAQIYLHP 255

  Fly   188 GFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDL---NLQISGWDPTKSSQ---TL 246
            .:.:|  ...:||.|::|..||.||..::|:.|    :|:.|:   .|...|:..|..:|   .:
  Fly   256 LYNAS--LNYHDIGLIQLNRPVEYTWFVRPVRL----WPMNDIPYGKLHTMGYGSTGFAQPQTNI 314

  Fly   247 ITS------TVKERN---PADCLNRYPSFRSASQVCAGGQRKG-DTCAGISGSPVMGIM------ 295
            :|.      .:::.|   |||  ...|.....||:||....|. |||.|.||.|:...:      
  Fly   315 LTELDLSVVPIEQCNSSLPAD--EGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERRRRR 377

  Fly   296 -GSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLAP 341
             .|......:|.||.||| .||.|. :|||||::..:.:||.:.:.|
  Fly   378 HTSRKHYRYYLVGITSYG-AYCRSE-LPGVYTRVSSYIDWIASIVWP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 4/12 (33%)
Tryp_SPc 108..338 CDD:238113 77/264 (29%)
Tryp_SPc 108..335 CDD:214473 75/261 (29%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.