DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and snk

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:359 Identity:97/359 - (27%)
Similarity:141/359 - (39%) Gaps:119/359 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LAECVRLSSCQKDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQC--------GLDPNGHELL 77
            ||:.:..:.||:.....|.:.       |...|.|      |:.:||        |..|..|.|.
  Fly   146 LAQRISATKCQEYNAAARRLH-------LTDTGRT------FSGKQCVPSVPLIVGGTPTRHGLF 197

  Fly    78 -HMVYVCCPELG----------DVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRLSL 131
             ||.     .||          |:   |..||         ||..:||                 
  Fly   198 PHMA-----ALGWTQGSGSKDQDI---KWGCG---------GALVSEL----------------- 228

  Fly   132 IRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTY 196
              ||||||||...|....:     .||||...    .:|:.....|:::....:|..:.||  .|
  Fly   229 --YVLTAAHCATSGSKPPD-----MVRLGARQ----LNETSATQQDIKILIIVLHPKYRSS--AY 280

  Fly   197 RNDIALLRLQFPVRYTKKIQPICLLDAEFP-LQDLNLQISGWDPT-----KSS------------ 243
            .:|||||:|...|:::::::|.||.  :.| ||...:..:||..|     ||:            
  Fly   281 YHDIALLKLTRRVKFSEQVRPACLW--QLPELQIPTVVAAGWGRTEFLGAKSNALRQVDLDVVPQ 343

  Fly   244 QTLITSTVKERNPADCLNRYPSFRSASQVCAG---GQRKGDTCAGISGSPVMGIMGSGVDEF--- 302
            .|......|||       |.|......|.|||   |.|  |||.|.||.|:..::    .|:   
  Fly   344 MTCKQIYRKER-------RLPRGIIEGQFCAGYLPGGR--DTCQGDSGGPIHALL----PEYNCV 395

  Fly   303 VFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            .|:.||.|:| ::|.:...|||||::..:.:||:
  Fly   396 AFVVGITSFG-KFCAAPNAPGVYTRLYSYLDWIE 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 13/57 (23%)
Tryp_SPc 108..338 CDD:238113 74/253 (29%)
Tryp_SPc 108..335 CDD:214473 72/250 (29%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 86/306 (28%)
Tryp_SPc 186..427 CDD:214473 84/303 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.