DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG13318

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:284 Identity:80/284 - (28%)
Similarity:117/284 - (41%) Gaps:47/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 VCCPELGDVLPNKQTCGQ---TTPVFRDRGAENAELNEYPWMVLLL-----YENRLSLI--RYVL 136
            |.|.:.|     ...||:   ..|.........|....|||...||     |....:||  ::||
  Fly   141 VACCQAG-----SYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTTADVYLGGGALITAQHVL 200

  Fly   137 TAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIA 201
            ||||.|....||     ...|||||  .|..::....|..||.:....|:..|..:  ..:||:|
  Fly   201 TAAHKVYNLGLT-----YFKVRLGE--WDAASTSEPIPAQDVYISNVYVNPSFNPN--NLQNDVA 256

  Fly   202 LLRLQFPVRYTKK--IQPICLLDAEFPLQDLNLQISGWDPTKSSQTLITSTVKER------NPAD 258
            :|:|..||..|.|  :..:||....|..|  ...::||.......|.....::.:      ..|:
  Fly   257 ILKLSTPVSLTSKSTVGTVCLPTTSFVGQ--RCWVAGWGKNDFGATGAYQAIERQVDVPLIPNAN 319

  Fly   259 CLNRYPSFRSASQ--------VCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQY 315
            |.....:.|..|.        :||||:...|.|.|..|||:: ...:||   .::.|:.::|.. 
  Fly   320 CQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLV-CTSNGV---WYVVGLVAWGIG- 379

  Fly   316 CYSAGIPGVYTKIGHFSEWIKANL 339
            |..||:||||..:|.:..||:..|
  Fly   380 CAQAGVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 1/1 (100%)
Tryp_SPc 108..338 CDD:238113 73/252 (29%)
Tryp_SPc 108..335 CDD:214473 71/249 (29%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 73/248 (29%)
Tryp_SPc 169..399 CDD:214473 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.