DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Prss45

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:335 Identity:92/335 - (27%)
Similarity:131/335 - (39%) Gaps:99/335 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SCSPLMNILRPRGMTQAEKDVFAHRQCGLDPN-GHELLHMVYVC-CPELGDVLPNKQTCGQTTPV 103
            :|...:.:|.||                  || |:...|...|| .|...|.|            
  Rat    21 TCFAALLLLPPR------------------PNLGYNEDHAEPVCGAPWWSDSL------------ 55

  Fly   104 FRDRGAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGG--YLTQNDLVLKSVRLG 160
                    .|.:.:||.|.|..||..    :||  .:|::||||:.|.  ||         |.||
  Rat    56 --------EERHHWPWEVSLQIENEHVCGGALIDQSWVVSAAHCIQGNKEYL---------VMLG 103

  Fly   161 ESTTDCITSESRCP-HLDVEVGQTTVH-----QGFTSSGGTYRNDIALLRLQFPVRYTKKIQPIC 219
            .||    ...|..| .|.:.||...:|     |.|      .|:|||||.|:.||.:.|.|||||
  Rat   104 SST----LQPSGSPWALKIPVGDIIMHPKYWGQNF------IRSDIALLCLETPVTFNKYIQPIC 158

  Fly   220 LLDAEFPLQ-DLNLQISGWDPTKS--SQTLI---------TSTVKERNPADCLNR---YPS---F 266
            |.:..|.|: .:...::||...|.  |..|.         .|.|..:|.....::   ||.   .
  Rat   159 LPEHNFNLKVGMKCWVTGWGQAKQHPSAKLTRSLELWEAEVSIVDNKNCDRVFHKKTFYPQVIPL 223

  Fly   267 RSASQVCAGGQRKGDTCAGISGSPV-MGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGH 330
            ...:.:|....|: :.|.|..|.|: ..:.|..:     ||||.|: ::.|..|....|||:|..
  Rat   224 IRKNMICTTNHRE-NPCYGDPGGPLACEVHGRWI-----LAGIFSW-EKACTKAPNLSVYTRIDK 281

  Fly   331 FSEWIKANLA 340
            ::.|||..::
  Rat   282 YTGWIKEQVS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 10/44 (23%)
Tryp_SPc 108..338 CDD:238113 79/262 (30%)
Tryp_SPc 108..335 CDD:214473 76/259 (29%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 79/257 (31%)
Tryp_SPc 57..286 CDD:214473 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.