DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and MP1

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:372 Identity:113/372 - (30%)
Similarity:160/372 - (43%) Gaps:80/372 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNG-----HELLHMVYVCC---------PE 86
            |..|..|..|..:|:...:|:.::......|||. .||     |.....|.:||         |:
  Fly    39 CINLRECGYLFELLQSEEVTEQDRRFLQASQCGY-RNGQVLEKHFCFTNVQICCANSRMRNQQPQ 102

  Fly    87 LGD-----------------VLPNKQTCGQTTPVFRDR--GAENAELNEYPWMVLLLYEN----- 127
            .|:                 :||....||:.   |.||  |.......|:|||.|:.|..     
  Fly   103 WGNHPQPTQTTKPTKRSGTKLLPMAPNCGEN---FGDRVVGGNETTKREFPWMALIEYTKPGNVK 164

  Fly   128 ----RLSLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGE----STTDCITSES---RC--PHLD 177
                ..|||  ||||||||||..   ..:|..|..|||||    :..||...::   .|  |::|
  Fly   165 GHHCGGSLINHRYVLTAAHCVSA---IPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVD 226

  Fly   178 VEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNL------QISG 236
            ..|.:...|..:..:.....||||||||:..|:|:..|.|:||  .....|..|:      .::|
  Fly   227 YPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCL--PTLASQHNNIFLGRKVVVAG 289

  Fly   237 WDPTKSSQTLITSTVKERNPAD------CLNRYPSFR---SASQVCAGGQRKGDTCAGISGSPVM 292
            |..|   :|..||.:|.:...|      |..||.:.|   :..|:||||....|:|.|.||.|::
  Fly   290 WGRT---ETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLL 351

  Fly   293 GIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            ....|..:...::||:.|||...|...|.|||||::..:..||:.|:
  Fly   352 LEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 13/52 (25%)
Tryp_SPc 108..338 CDD:238113 88/264 (33%)
Tryp_SPc 108..335 CDD:214473 86/261 (33%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855 13/52 (25%)
Tryp_SPc 137..394 CDD:214473 87/264 (33%)
Tryp_SPc 138..397 CDD:238113 88/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463217
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.