DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG9372

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:360 Identity:94/360 - (26%)
Similarity:154/360 - (42%) Gaps:70/360 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NQLAECVRLSSCQ----KDEKCTRLVSCSPLMNILRPRGMTQAEKDVF--AHRQCGLDPNGHELL 77
            :||.|.....:|.    :..:|..::.|.          |.:.:.||:  ..:.|.::.:.    
  Fly    76 SQLLENKDYGACSTPLGESGRCRHIIYCR----------MPELKNDVWRLVSQLCIIEKSS---- 126

  Fly    78 HMVYVCC----------PEL-----GDV-----LPNKQTCGQTTPVF-RDRGAENAELNEYPWMV 121
              :.:||          |::     ||.     .|.::.||.|:..| |..|...||.:|:|||.
  Fly   127 --IGICCTDQSTSNRFSPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMA 189

  Fly   122 LLLYENR--------LSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDV 178
            .||.|..        |...|:|||||||:   |....:.:.  |||||..|..: :|:|.  .|.
  Fly   190 ALLQEGLPFVWCGGVLITDRHVLTAAHCI---YKKNKEDIF--VRLGEYNTHML-NETRA--RDF 246

  Fly   179 EVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWDPTK-- 241
            .:....:|..:...  .|.||||::|:.....:...|.|:|:........|.|..::||...|  
  Fly   247 RIANMVLHIDYNPQ--NYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAIVTGWGTQKFG 309

  Fly   242 --SSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFV 303
              .|..|:...:.....:||.:.:......:.:|||....| |:|.|.||.|::..:.:  ..:|
  Fly   310 GPHSNILMEVNLPVWKQSDCRSSFVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPN--QRWV 372

  Fly   304 FLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKAN 338
            .: ||.|:|.. |...|.||:||::..:.:||.||
  Fly   373 TI-GIVSWGVG-CGQRGRPGIYTRVDRYLDWILAN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 6/50 (12%)
Tryp_SPc 108..338 CDD:238113 71/242 (29%)
Tryp_SPc 108..335 CDD:214473 69/239 (29%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 8/60 (13%)
Tryp_SPc 173..402 CDD:214473 70/242 (29%)
Tryp_SPc 176..402 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.