DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG18223

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:210 Identity:54/210 - (25%)
Similarity:88/210 - (41%) Gaps:25/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 YVLTAAHCVIGGYLTQNDLVLKS--VRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTY 196
            |:||:|||.    :.:..:|.:|  :.:...||:.:.|.... .|::||.:..|...||...   
  Fly    88 YILTSAHCA----MDKRKIVHRSRVLVVVAGTTNRLKSRKGL-SLNMEVKKIFVPDKFTVFN--- 144

  Fly   197 RNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWDPTKSSQTLITSTVK---ERNPAD 258
            .|:|||:.|...:.....:..:..|....|...||..:.||........|.:..:.   |..|.|
  Fly   145 TNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLASDILHIDVELLPRD 209

  Fly   259 CLNRYPSFRSASQVCAGGQRK---GDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAG 320
            ...:.........:|||....   .:.|||.:|||::      .:|.||  |:.|| :..|.|..
  Fly   210 ICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLI------FNETVF--GVVSY-RVGCGSKT 265

  Fly   321 IPGVYTKIGHFSEWI 335
            :|.:||.:....:||
  Fly   266 LPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 54/210 (26%)
Tryp_SPc 108..335 CDD:214473 52/208 (25%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 54/210 (26%)
Tryp_SPc 60..280 CDD:214473 52/208 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.