DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG10663

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:419 Identity:97/419 - (23%)
Similarity:138/419 - (32%) Gaps:147/419 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRKVYILVLLQAIFFNQLAECVRLSSCQKDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCG 68
            |||||                         .|.:|...|||.....|             :::|.
  Fly   377 RRKVY-------------------------SKWSRWTKCSPKCTTRR-------------YKKCR 403

  Fly    69 -LDPNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDR------------------------- 107
             :|..|.|:|..:..|..|........||..|.||.|..|                         
  Fly   404 IMDQCGREVLREIAYCYTEGSFCQQWLQTQFQKTPAFETRPGSGSPANAMRRMQSEQPEVSMNDL 468

  Fly   108 ----------------------------------------GAENAELNEYPWMVLLLYENRL--- 129
                                                    |...|...|:||.|.:|  ||.   
  Fly   469 NYIMTGKGYRGPEYTPLKLSCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAIL--NRFKEA 531

  Fly   130 ----SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQG 188
                :||  |:||||||||         ..:..||:||...:....    ..:.:.|.::..|..
  Fly   532 FCGGTLIAPRWVLTAAHCV---------RKVLFVRIGEHNLNYEDG----TEIQLRVMKSYTHPN 583

  Fly   189 FTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQ----DLNLQISGW------DPTKSS 243
            |...  |..:|:|||||...|..|..|...||..   |.|    :::..|.||      |.|.:|
  Fly   584 FDKR--TVDSDVALLRLPKAVNATTWIGYSCLPQ---PFQALPKNVDCTIIGWGKRRNRDATGTS 643

  Fly   244 QTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKG--DTCAGISGSPVMGIMGSGVDEFVFLA 306
             .|..:||......:|...|..:.....:...|.:||  |||||.||.|::....:..:....:.
  Fly   644 -VLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIF 707

  Fly   307 GIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            ||.|:|.. |......|:|.|:.::.:|:
  Fly   708 GITSFGDG-CAQRNKFGIYAKVPNYVDWV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 11/49 (22%)
Tryp_SPc 108..338 CDD:238113 72/249 (29%)
Tryp_SPc 108..335 CDD:214473 71/247 (29%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 71/250 (28%)
Tryp_SPc 507..735 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.