DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG11529

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:257 Identity:69/257 - (26%)
Similarity:112/257 - (43%) Gaps:66/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LNEYPWMVLL----LYENRL----SLI--RYVLTAAHCVIGGYLTQNDLVL--KSVRLGESTTDC 166
            :.::|:.|:|    |:..|:    :|:  |::|||.||.:|  :|..|:.|  |||.        
  Fly    38 IEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMG--VTHYDVYLGTKSVE-------- 92

  Fly   167 ITSESRCPHLDVEV--------GQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDA 223
                      |.||        .:..||:.|...  |..|||||::|...|.:|.:|||     |
  Fly    93 ----------DTEVSGGLVLRSNKFIVHERFNPE--TAANDIALVKLPQDVAFTPRIQP-----A 140

  Fly   224 EFP-------LQDLNLQISGW----DPTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQ 277
            ..|       ...:::..|||    :.|.|.....|. :|..:.|:|...|....| ..:||.|.
  Fly   141 SLPSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTE-LKVISNAECAQEYDVVTS-GVICAKGL 203

  Fly   278 RKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            :....|.|.||.|::      :.:...:.||.|:|........|||.:|::.|:.:||::.:
  Fly   204 KDETVCTGDSGGPLV------LKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 69/254 (27%)
Tryp_SPc 108..335 CDD:214473 67/251 (27%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 69/254 (27%)
Tryp_SPc 37..255 CDD:214473 67/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.