DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG18180

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:95/269 - (35%) Gaps:80/269 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 RGAENAELNEY-------PWMVLLLYENRLS---------LIR--YVLTAAHCVIGGYLT----- 148
            :|||...:|.|       |::|.|......|         :|.  ::||||||:.|.|:.     
  Fly    30 QGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGS 94

  Fly   149 ---QNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVR 210
               .|....::||     .|...|                |..:.|.||   .||.|:|... |.
  Fly    95 NWGWNGAYRQTVR-----RDNFIS----------------HPDWPSQGG---RDIGLIRTPH-VD 134

  Fly   211 YTKKIQPICLLDAEFPLQDLNLQ----------ISGW---DPTKSSQTLITSTVKERNPADCLNR 262
            :...|..|       ||..:|.|          ..||   |....:..|....|:..:.::|...
  Fly   135 FNGLINKI-------PLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQA 192

  Fly   263 YPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTK 327
            |.|..| :.:|.........|.|.||.|::      ..:...|.|:.::....|:..  |..||:
  Fly   193 YGSVAS-TDMCTRHADGKSVCGGDSGGPLV------THDNARLVGVITFASVSCHDG--PSGYTR 248

  Fly   328 IGHFSEWIK 336
            :..:.|||:
  Fly   249 VSDYLEWIR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 62/268 (23%)
Tryp_SPc 108..335 CDD:214473 60/265 (23%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 57/261 (22%)
Tryp_SPc 36..259 CDD:238113 59/263 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.