DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG18179

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:263 Identity:59/263 - (22%)
Similarity:94/263 - (35%) Gaps:66/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEY-------PWMVLLLYE-----------NRLSLIRYVLTAAHCVIGGYLT------ 148
            |||...:|.|       |::|.||..           ..:....::||||||:...|:.      
  Fly    35 GAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSN 99

  Fly   149 --QNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRY 211
              .|....:|||     .|...|                |..:.:.||   .||.|:|.. .|.:
  Fly   100 WGWNGAFRQSVR-----RDNFIS----------------HPNWPAEGG---RDIGLIRTP-SVGF 139

  Fly   212 TKKIQPICL---LDAEFPLQDLNLQISGW---DPTKSSQTLITSTVKERNPADCLNRYPSFRSAS 270
            |..|..:.|   .:......|......||   |....:..|....|:..:.::|...|.:..| :
  Fly   140 TDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVAS-T 203

  Fly   271 QVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            .:|........:|.|.||.|::      ..:...|.|:.::|...|:|.  |..||::..:..||
  Fly   204 DMCTRRTDGKSSCGGDSGGPLV------THDNARLVGVITFGSVDCHSG--PSGYTRVTDYLGWI 260

  Fly   336 KAN 338
            :.|
  Fly   261 RDN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 58/261 (22%)
Tryp_SPc 108..335 CDD:214473 56/258 (22%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 53/254 (21%)
Tryp_SPc 40..263 CDD:238113 55/256 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.